PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10005698m
Common NameCARUB_v10005698mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 220aa    MW: 25021.5 Da    PI: 9.3786
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10005698mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.11.9e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEd++l d+v+ +G g+W++Ia++ g++R++k+c++rw +yl
  Carubv10005698m 14 KGLWTVEEDKILMDYVRTHGQGHWNRIAKKTGLKRCGKSCRLRWMNYL 61
                     678*******************************************97 PP

2Myb_DNA-binding60.34.3e-1967112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E++l+++++k+lG++ W++Ia++++ gRt++q+k++w+++l
  Carubv10005698m  67 RGNFTDQEEDLIIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.72961IPR017930Myb domain
SuperFamilySSF466894.58E-3112108IPR009057Homeodomain-like
SMARTSM007172.9E-151363IPR001005SANT/Myb domain
PfamPF002496.6E-171461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-251568IPR009057Homeodomain-like
CDDcd001671.48E-121761No hitNo description
PROSITE profilePS5129427.72462116IPR017930Myb domain
SMARTSM007172.1E-1866114IPR001005SANT/Myb domain
PfamPF002496.9E-1867112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-2769116IPR009057Homeodomain-like
CDDcd001675.18E-1469112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010053Biological Processroot epidermal cell differentiation
GO:0010091Biological Processtrichome branching
GO:0048629Biological Processtrichome patterning
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MRMTRDGKEH EYKKGLWTVE EDKILMDYVR THGQGHWNRI AKKTGLKRCG KSCRLRWMNY  60
LSPNVNRGNF TDQEEDLIIR LHKLLGNRWS LIAKRVPGRT DNQVKNYWNT HLSKKLGLGD  120
HSSGAKPARD SESPPSLALI TTTSSSPQEM AGEKVSTVRF DTLVDESKLK PKPKPVHSLP  180
TDVEVAATVP NLFDTFWVLE DDFELSSLTM MDFTNGYCI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28141167108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00538DAPTransfer from AT5G40330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196310.0AY519631.1 Arabidopsis thaliana MYB transcription factor (At5g40330) mRNA, complete cds.
GenBankBT0252850.0BT025285.1 Arabidopsis thaliana At5g40330 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006282714.11e-164hypothetical protein CARUB_v10005698mg
SwissprotQ962761e-151MYB23_ARATH; Transcription factor MYB23
TrEMBLR0F1W91e-164R0F1W9_9BRAS; Uncharacterized protein
STRINGAT5G40330.11e-149(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40330.11e-152myb domain protein 23